Pyc Therapeutics Limited · ASX:PYC
Pyc Therapeutics — Phylogica — Shareholder Meeting (November 2009)
25 slides from Pyc Therapeutics's shareholder meeting presentation, Nov 25, 2009
Slide 1: Phylogica Ltd
Phylogica Ltd For personal use only Paul Watt www.phylogica.com
Slide 2: Forward-looking statements
Forward-looking statements This presentation includes forward-looking statements that are subject to risks and uncertainties. Such For personal use only statements involve known and unknown risks and important factors that may cause the actual results, performance or achievements of Phylogica to be
Slide 3: Introduction to Phylogica Ltd
Introduction to Phylogica Ltd For personal use only Phylogica Limited is a specialist drug discovery company with a proprietary source of diverse compounds Spun out from TICHR (Perth) and the Fox Chase Cancer Center (Philadelphia) Phylogica has a strong patent position protecting its unique peptide
Slide 4: Experienced Board
Experienced Board Mr Harry Karelis – Deputy Chairman For personal use only • Established major Australian life sciences fund, BioTech Capital • Board member of several private and public life sciences companies • Experience in financial analysis, funds management in Australia and Overseas Mr Bruce M
Slide 5: Experienced Board
Experienced Board For personal use only Dr Douglas Wilson - Executive Chairman • Former Senior Vice-President, Medicine for Boehringer Ingelheim • Overseen multiple drugs at all phases of development including bringing many drugs successfully to the market in the USA Dr Paul Watt – CSO and VP Corpor
Slide 6: Phylomer® Peptides
Phylomer® Peptides a diverse class of peptides from natural proteins Phylomers® represent a new class of peptides derived from natural For personal use only protein fragments encoded by biodiverse ancient bacterial genomes Phylomer libraries contain billions of distinct peptides from diverse branche
Slide 7: Phylomer® Peptides
Phylomer® Peptides a diverse class of peptides from natural proteins For personal use only From 30 characterised bacterial genomes we have derived billions of distinct Phylomer® peptides from thousands of classes of protein structural folds The world’s richest source of diverse natural secondary and
Slide 8: Why Peptides?: The limits of small-molecule based drug discovery
Why Peptides?: The limits of small-molecule based drug discovery The Druggable Genome For personal use only Druggable Genes Therapeutic Genes <1500 3000 genes genes 6000 genes All conventional small molecule drugs are directed at only about 300 human targets: The ‘low hanging fruit’ is running out
Slide 9: Biologics enable access to a much larger target space
Biologics enable access to a much larger target space The benefits of using biological drug sources such as pep5des For personal use only Druggable Genes Therapeu(c Genes 10,000 genes 3,000 genes 6,000 genes
Slide 10: Harvesting the power of structural diversity for drug discovery
Harvesting the power of structural diversity for drug discovery For personal use only Phylomers libraries contain multiple classes of subdomain and supersecondary structures from diverse evolutionary protein lineages Watt, PM (2009) Future Medicinal Chemistry 1 (2)
Slide 11: Phylomer hits belong to multiple structural families: diversity of shapes
Phylomer hits belong to multiple structural families: diversity of shapes Bacteroides: (40L_0859) Bordetella: (40L_0716) Haloarcula: (40L_0735) For personal use only Homologous Crystal Structure S. enterica. E. coli. B. stearothermophilus (dTDP-D-glucose 4,6-dehydratase) (Ferric siderophore receptor
Slide 12: Structurally related families of Phylomer hits
Structurally related families of Phylomer hits For personal use only Glycl-tRNA synthetase alpha subunit Crystal (40L_1064) Homology Model (40L_1064) 82% ID MODBASE Thermotogoa maritima
Slide 13: Docking of Phylomer onto target surface
Docking of Phylomer onto target surface (with 40L_1064 (Q7W0Q6_112-150) For personal use only VEDDWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLDC Key Interactions: Val112 - R203 (Hydro) Glu113 - R203 (Elec) Glu113 - T251 (W.Elec) Asp114 - G144 (W.Elec) Glu117 - K143 (W.Elec) Glu117 - H249 (Elec) Pro119 - S132;
Slide 14: Thermal stability of Phylomers: good shelf-life and more stable in the body
Thermal stability of Phylomers: good shelf-life and more stable in the body -The His-40L-1064 clone (800 nM) was heated to 95 oC for 30 minutes and allowed to cool to room temperature For personal use only Stable Phylomer Association Step Dissociation Step Unstable Protein partner (CD40L)
Slide 15: Flexible approach for converting hits to drug-leads
Flexible approach for converting hits to drug-leads For personal use only Screening Synthesis Filter Maturation PK Phage Display High Throughput Phage Display Specificity Mutagenesis PEGylation Synthesis Pure Long Lived Serum Yeast Two Hybrid Pure Peptide Peptide Affinity Affinity Multimerisation Pr
Slide 16: Antimicrobial Therapeutics: A Critical Area of Unmet Need
Antimicrobial Therapeutics: A Critical Area of Unmet Need Common organisms (eg.Pseudomonas /Acinetobacter) with emerging resistance to conventional antibiotics in hospitals For personal use only Drug Resistant Acinetobacter baumannii, an emerging nosocomial pathogen • Gram-negative; non-motile; wide
Slide 17: Potent antimicrobial activity of Phylomers on clinical strains with minimal toxicity
For personal use only Potent antimicrobial activity of Phylomers on clinical strains with minimal toxicity Minimal Inhibitory Concentrations (MIC) for complete inhibition of growth (µM) Synthetic Peptide A. baumannii S. aureus P. aeruginosa K. pneumoniae Haemolytic activity MHC10 (µM) Ac5r 15 10 >60
Slide 18: Patient friendly delivery of Phylomer peptides to avoid injection
Patient friendly delivery of Phylomer peptides to avoid injection For personal use only Injected Inhaled Peptide 40kDa PEG Phylomer 5kDa PEG Phylomer Albumin binding Affibody Phylomer Albumin binding Affibody Phylomer Intravail® Excipient Sales of the calcitonin peptide increased more than 30-fold u
Slide 19: Intranasal delivery of Phylomers in acute airways inflammation
Intranasal delivery of Phylomers in acute airways inflammation Animals were either untreated (control), given LPS alone (open bars), given LPS and treated with scrambled peptide (filled bar), or treated with Phylomers (hatched bars) and BAL For personal use only performed 6 hour post LPS administrat
Slide 20: Phylomer® Peptide Advantages
Phylomer® Peptide Advantages Amenable to chemical synthesis For personal use only • Scalable and controllable • Cost-effective • Customisation of drug properties Alternative delivery potential • Intra-nasal, sub-lingual Best quality (affinity) and quantity (hit-rate) of hits in peptide world Access
Slide 21: Intellectual Property
Intellectual Property integrated patent portfolio For personal use only Phylogica owns the most comprehensive collection of peptide structures found in nature Patents cover methods of making and screening Phylomer libraries and composition-of-matter on peptides 14 patent families, 26 granted/ allowe
Slide 22: Commercialisition Strategy
Commercialisition Strategy Phylogica’s current strategy is to demonstrate application of its platform against a range of targets and disease models and to incrementally grow For personal use only its contract discovery business to help fund growth of capital value to exit Multiple medium term value-
Slide 23: M&A activity in biologics discovery field
M&A activity in biologics discovery field For personal use only Eight acquisitions of companies with biologics discovery libraries in less than 2 years Companies that have developed new classes of peptide/ protein based drug have been acquired for an average valuation of A$450M 62% of acquired compa
Slide 24: Progress to increase shareholder value
Progress to increase shareholder value For personal use only Significant positive progress has been made over past 12 months Phylogica’s proprietary libraries now validated as world class Lower risk business model which generates early revenue Numerous partnering discussions underway for Phylogica t
Slide 25: Phylogica's team, collaborators & co-development partners
Phylogica’s team, collaborators & co-development partners www.phylogica.com For personal use only