Vaxart, Inc. · OTC:VXRT
Vaxart — Technical Presentation (November 2020)
27 slides from Vaxart's technical presentation, Nov 19, 2020
Slide 1: KOL Event: Unlocking the Full Potential of Oral Vaccines
KOL Event UNLOCKING THE FULL POTENTIAL OF ORAL VACCINES
Slide 2: Forward-Looking Statement
Forward-Looking Statement VAXART This presentation contains forward-looking statements that involve substantial risks and uncertainties. All statements, other than statements of historical facts, included in this presentation regarding Vaxar's strategy, prospects, plans and objectives, results from
Slide 3: Norovirus is a Significant Cause of Disease in the U.S.
ip Norovirus is a Significant Cause of Disease in the U.S. VAXART Median cost to U.S. Healthcare system (2013-2017): $10.6 n annually? Estimated_ifetime Risk of Norovirus ‘The Economie Burden of Norovieus Gastroenteritis in the United States 419-24 Millon ‘Moco mom ry a 4 1.74.9 Million = mary Outpa
Slide 4: Government Policy Expected to Drive $3B+ U.S. Market
Government Policy Expected to Drive $3B+ U.S. Market VAXART CDC (Viral Gastroenteritis Branch) Highly Engaged with Norovirus Disease = 2. Form working runt inform Advisory Commitee of Immunization Paces (AD) ACIP Recommends U.S. Vaccine Policy to Age 04 5-64 65+ Director of CDC Population US 20M ‘26
Slide 5: How Vaccines Work with the Immune System
How Vaccines Work with the Immune System VAXART * Recognizes the germ component in the vaccine as being foreign. * Responds by making antibodies and T cells to the germ component in the vaccine, just as it would for the real germ. Effector Response * Remembers the germ and how to destroy it. That wa
Slide 6: Oral Vaccines Based on VAAST Platform
ip Oral Vaccines Based on VAAST Platform VAXART Selected Mucosal Adjuvant “Hard Wired” in Vector Delivery System Non-replicating adenovirus with molecular adjuvant ORAL VACCINE OFFERS IMPORTANT INNOVATIVE PLATFORM ADVANTAGES SYSTEMIC AND LOCAL IMMUNITY * Potentially disruptiveimpact + Designed for w
Slide 7: VAAST Oral Vaccines — Validated Platform In Humans
ip VAAST Oral Vaccines — Validated Platform In Humans VAXART Approximately 500 Subjects Dosed to Date Flu RSV Norovirus (GOV 245 46 Clinical Trials SUBJECTS Tablet Vaccines DOSED mM s ie SAFETY = Favorable safety and tolerability profile EFFICACY Purpose: Reduction in influenza illness comparable wi
Slide 8: Two Layers of Protection
Two Layers of Protection 3) Mucosal SIgA and Serum IgG VAXART Mucosal Response may be able to block infection more effectively at the site of infection Epithelial Cells Enteric Viruses Respiratory | Viruses e e ° e | =. e ‘ [uae Ree. ns
Slide 9: Human Norovirus Bivalent Trial (Oral tablets)
Human Norovirus Bivalent Trial (Oral tablets) 3) Similar B cell Response - Bivalent vs Monovalent VAXART * Norovirus specific B cells (plasmablasts) are induced by vaccination. * Counted by Antibody Secreting Cell (ASC) assay * IgA ASC have correlated to protection in other enteric pathogen studies
Slide 10: Oral Vaccination Generates an Immune Response Similar to Infection
Oral Vaccination Generates an Immune Response Similar 3) to Infection VAXART Mucosal Homing B Cells Plasmablasts 7 days post- Norovirus Vaccination ow a ae ae 4 F a 8 days post- Norovirus Infection 10
Slide 11: Vaccines work by Memory and Effector Responses
Vaccines work by “Memory” and “Effector” Responses; 3) We can generate mucosal homing cells of both types. VAXART Gated on B7(high) CD19+0487(high) IgA aOR Day 7 p70 ad4 Tong FEAT OT i a Effector Sonera — _ ee cD19 S wane polite) a ue Adopted from Kim, at al, JCI Insights 2018 a
Slide 12: Vaxart Norovirus Tablet Vaccine Increases Memory B cells
Vaxart Norovirus Tablet Vaccine Increases Memory B cells) Vvaxart IgG and IgA Memory B cells both increase in blood with vaccination *° The lgA memory B cells are likely leaving circulation by day 28 whereas significant numbers of IgG are still present Memory B cell Response to Norovirus in human bl
Slide 13: Increase in Mucosal IgA to VP1 can be found in Fecal Samples
Increase in Mucosal IgA to VP1 can be found in Fecal Samples 3) Post Immunization VAXMART Substantial Effector B cells Homing to Mucosal Sites induce Local IgA Response to VP1 Post Immunization Fecal IgA response Fold Increase in VP1 IgA Fecal IgA measured by Marcela Pasetti, U Maryland, Baltimore a
Slide 14: Norovirus Oral Tablet Results
Norovirus Oral Tablet Results VAXART Strong Induction of antigen specific B cells * No interference between the two strains detected * Memory Cell Induction, both IgA and IgG * Migration of the memory cells out of the peripheral blood * Induction of mucosal IgA * Vaxart has restarted the norovirus v
Slide 15: Vaxart — COVID Vaccine Issues
ip Vaxart — COVID Vaccine Issues VAXART * Covid-19 is a significant health problem. A vaccine solution is possible. Lots of injected vaccine solutions are in late-stage trials * Several limitations for roll-out of a needle solution during a pandemic Need a qualified health care provider to administe
Slide 16: Vaxart — Oral Tablet COVID Vaccine Program
ep Vaxart — Oral Tablet COVID Vaccine Program VAXART * Goal: Make a candidate that can induce robust antibody and T responses both systemically (blood) as well as mucosally (lungs, intestine, etc) © Oral delivery should induce a broader immune response than an injected vaccine ° Made several clinica
Slide 17: Coronaviruses — Large RNA viruses
Coronaviruses — Large RNA viruses VAXART A. $2 Te aoe [eps [et RdRp Hel $1: Receptor Binding Domain SARS-CoV a ar n Cosy cae (SARS-CoV-2_* fro} — 7m N ee, 2: Membrane Binding Domain | -_ e HR2 TM CP syst -R| Suse s0-PRSVR|S-1 2 Fusion Peptide -PTKR | SFIEDLLFNKVTLADAGEMKQYGECLGDINA~RRDLICAQKE-11 RSA
Slide 18: rAd-S-N (VXA-CoV2-1) was superior to truncated forms of S protein in mice
Vaxart’s rAd-S-N (VXA-CoV2-1) was superior to truncated 3) forms of the S protein in mice VAXMART ¢ S- Binding antibody responses equivalent for several different candidates * Neutralizing antibody responses were better with the rAd-S-N (VXA-CoV2-1) * Lung Antibody Titers better with full-length S p
Slide 19: Vaxart's Vaccine induces potent antibody responses in hamsters
Vaxart’s Vaccine induces potent antibody responses in 3) hamsters VAXMART * Oral and intranasal delivery of VXA-CoV2-1 produced a similar antibody response with titers above 10,000 Serum IgG anti-S ELISA a Pre Challenge Post Challenge 10°. 2 10%. S 10°. = VKA-CoV2-1 oral 8 g “i VXA-CoV2-1 in. = 40 -
Slide 20: Oral Vaccine substantially protects against lung infection in hamsters
Vaxart’s Oral Vaccine substantially protects against lung 3) infection in a hamster challenge model VAXMART * Viral load in lungs reduced by >10,000 fold qRT-PCR Lung Data Post Challenge in Hamsters 40% 40" E10". s 310°. 8 a 10°. eK eK © 107 4 2 10° & 10° LoQ 10%. 10°. T T T VXA-CoV2-1 VXA-CoV2-1 No
Slide 21: VXA-COV2-101 Phase 1 Study Design and Schema
VXA-COV2-101 Phase 1 Study Design and Schema VAXART a VXA-CoV2-1 1x10" 1.U. a Ses aera eT | Gohort2veacover atu. ME ec sco. 1 z Active Period (57 Days) Safety Follow-up Period (through Day 390) icity, Safety and Immunogenicity) (Duration of Immune Response, SAEs and MAAEs, including COVID-19) Screen
Slide 22: Solicited Symptoms Post First Vaccination
Solicited Symptoms Post First Vaccination VAXART Solicited Sympt Days (1-8) No. (%) with Solicited Symptoms Gastrointestinal Symptoms Diarrhea 0 (00) 1 (6.7) Nausea 0 (00) 3 (20) Vomiting 0 (00) 0 (00) Abdominal Pain 1 (5.0) 0 (00) General Symptoms Malaise/Fatigue 2 (10) 0 (00) Myalgia (Muscle Pain)
Slide 23: Sentinel Analysis — Day 8 Post Vaccine Samples
ip Sentinel Analysis — Day 8 Post Vaccine Samples VAXART * Immune Responses in all subjects tested to date (N=4) * Expansion of the plasmablast population (B cells that will eventually make vaccine specific antibodies) * Increased ASC responses * Tcell responses — Heavy bias toward TH1 not TH2 — Spr
Slide 24: Increase in plasmablast frequencies on day 8 after vaccination
Increase in plasmablast frequencies on day 8 after ip vaccination VAXART CD27+IgD-B cells Plasmablasts (PB) B7 versus IgA "Taree cor “T, mone wt wt > (53.2% of total PB) x “|e ar oe ay 1e) we > a (pre- wo w! vaccination) os e708 0 we ea" sa Pa la Si a ha Fi be Man as tae hi CD38 B7 wt To BT+ ALPS al
Slide 25: Increase in CD8 T cell responses on day 8 after vaccination
Increase in CD8 T cell responses on day 8 after 3) vaccination VAXART CD8 T cells measured by intracellular cytokine staining post stimulation of PBMCswith the S — protein Peptidelibrary “1 4.9% |. CD8 Day 1 Day 8 (pre-vaccination) (post-vaccination) 2s
Slide 26: Summary — COVID vaccine results
ip Summary — COVID vaccine results VAXART * Vaxart’s clinical candidate selected based on increased mucosal immune responses in mice * Proven efficacious in a hamster challenge study * Human phase trial is completely enrolled — Well-tolerated safety profile based on solicited adverse events — Early
Slide 27: Acknowledgements
Acknowledgements VAXART * Vaxart Research Mario Cortese Susan Johnson Emery Dora Karen Lin Nadine Peinovich Clarissa Martinez * Vaxart Clinical Shaily Garg Josefina Martinez Stanford University Mark Davis Lisa Wagar David Mcllwain University College Cork Anne Moore Visimederi Laura Palladino Emanuel