Cellular Biomedicine Group Inc

Cellular Biomedicine — Technical Presentation (December 2019)

15 slides from Cellular Biomedicine's technical presentation, Dec 9, 2019

  1. Slide 1: Developing a Novel Anti-BCMA CAR-T for Relapsed or Refractory Multiple Myeloma

    Seto 2 “Developing a Novel Anti-BCMA CAR-T for Relapsed or,Refraetory Multiple ym. Myeloma’ *.- ® - , Yihong*Yao, Ph.D, CSO

  2. Slide 2: Forward-Looking Statements

    Forward-Looking Statements 4. CBMG ‘Statements in this presentation relating to plans, strategies, trends, specific activities or investments, and other statements that are not descriptions of historical facts and may be forward-looking statements within the meaning of the Private Securities Litigat

  3. Slide 3: Disclaimer

    Disclaimer Feamc + 1am the Chief Scientific Officer of Cellular Biomedicine Group, Inc. + Lown stock in Cellular Biomedicine Group, Inc.

  4. Slide 4: C-CAR088 is a 2nd Generation CAR with Human scFv

    C-CAR088 is a 2nd Generation CAR with Human scFv Feamc + scFv of C-CARO88 specifically targets epitome cluster E3 in BCMA extra-cellular domain 1 io 20 30" - 40 54 II}INGQCSONEY FDSLLHACTECOERCSSNTPPLRGQRYCNASMEINSVKGINA == ry E17 £28.21 £3:24-41 4:42.54 Neterminal First disulfide bound Second (doub

  5. Slide 5: ees

    ees ‘%Cytotoxicity NH929-8CMA Le < 2 os NT 5 ‘® Positive control 3 + CBMBCMA $ 2 ia 81 Tot 201 404 Effector Target ‘Ta ST 101 201 40T Effector-Target i 81 Tod 204 40 Effector-Target

  6. Slide 6: Cell Killing Activities Are Unaffected By Soluble BCMA

    Cell Killing Activities Are Unaffected By Soluble BCMA [rams {- ww {4 | 9" | The hg |

  7. Slide 7: C-CAR088 Showed Dose Dependent In Vivo Anti-tumor Activity

    C-CAR088 Showed Dose Dependent In Vivo Foam G Anti-tumor Activity Er Bere enn NSC mice were subcutaneous ieee wth 4x 10°RPM8226 cele Ate umere grow to an average volume of about 100 re, 2xIO% S10 andro" CART cal are ejected theta vein

  8. Slide 8: C-CAR088 CMC Summary

    C-CAR088 CMC Summary 1. Semi-automated, digital, closed system (Commercial Platform based on modified GE FlexFactory) 2. ~6 day manufacturing process, risk-based rapid product release 3 3. Serum free culture system 8 4. Institutionalized, highly repeatable 8 manufacturing process i cpaicos cpsico3 T

  9. Slide 9: Phase I Study in Relapsed or Refractory Multiple Myeloma

    Phase | Study in Relapsed or Refractory Multiple Myeloma fe CBMG a C-EAROGS tones wwciecugnce — Saoen —, Cina motoring and Bomarkerstiies ceo fd rm: Semon 1 SF memo Frist clinical response assessment 343 Dose Escalation Study Status’ Key Eligibility Criteria Safety Assessment : Rate of dose + 16-75

  10. Slide 10: Baseline Demographics and Clinical Characteristics

    Baseline Demographics and Clinical Characteristics ‘aves cy oe Ey ‘s DeeGaRe Toa) Tener Teaver Toon Tang Tenowe tet one iy 2018 ate azo 20 nora? iat type ma « Wao ra wean Terps ATT ta ms 3 - te or Bonen Borman Sore Sr Tenataemse | Asotin SET ry Tenaiaiie Pomakcone ‘eaorie Taso 867 | Aste ST Ben epee

  11. Slide 11: Treatment-emerging Adverse Events

    Treatment-emerging Adverse Events 4. CBMG = No grade 3 or 4 CRS events * No neurotoxicity events = No dose-limiting toxicities (DLTs) observed in dose escalation = Cytopenias mostly related to Cy/Flu lymphodepletion Cytokine release syndrome’ 4 (80) lo Neutropenia [5 (400) [5 (400) [Thrombocytopenia

  12. Slide 12: C-CAR088 Proliferation & Expansion in the Peripheral Blood Correlated with Decrease in Tumor Burden

    C-CAR088 Proliferation & Expansion in the Peripheral Blood Correlated with Decrease in Tumor Burden [cams JSPH-COOB_ 3x10 CART cellakg Pleural myeloma response to C-CAR088 Before wk After Tr" meyaer mart eo can eating RS Sov cant cong Blood CAR-T proliferation & expansion and decreasing of M protein

  13. Slide 13: Clinical Response - Data Cutoff Date November 30, 2019

    Clinical Response - Data Cutoff Date November 30, 2019 FcBmc m ORR: 100% in 5 evaluable patients Weeks after C:CAR0RS infusion

  14. Slide 14: Summary

    Summary a BMG * Our novel BCMA CAR-T appears to be a potentially promising therapy in accordance with the early observed data + In our preclinical studies, CARO88 is shown to eradicate BCMA positive tumor cells both in vitro and in vivo + Early clinical trial results in patients with r/r MM for C-CA

  15. Slide 15: Acknowledgements

    Acknowledgements Cellular Biomedicine Group Tony Liu Pre-Clinical Clinical Xin Yao Michael Humphries Shigui Zhu Judy Zhu Yutian Wei Chengxiao Zheng Caochan Zhang Production & QC Translational Medicine Li Zhang Jiagi Huang Jiagiang Ren Xiaoteng Lv Junfeng Wu Liping Lan RirFei Wang Cheng Chen Dingzhu

Cellular Biomedicine Group — Technical Presentation (December 2019) on 6ix